Lineage for d4u1gb_ (4u1g B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745372Domain d4u1gb_: 4u1g B: [409591]
    Other proteins in same PDB: d4u1gc1, d4u1gc2, d4u1gf1, d4u1gf2
    automated match to d6shgh_

Details for d4u1gb_

PDB Entry: 4u1g (more details), 3.1 Å

PDB Description: plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody qa1
PDB Compounds: (B:) QA1 monoclonal antibody heavy chain

SCOPe Domain Sequences for d4u1gb_:

Sequence, based on SEQRES records: (download)

>d4u1gb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlvesggglvkpggslklscaasgftfsdfymywvrqtpekrlewvatisdgdsyiyypd
svrgrftisrdnaknilflqmsslksedtamyfcardgngkdggdamdywgqgtsvtvss
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Sequence, based on observed residues (ATOM records): (download)

>d4u1gb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlvesggglvkpggslklscaasgftfsdfymywvrqtpekrlewvatisdgdsyiyypd
svrgrftisrdnaknilflqmsslksedtamyfcardgngkdggdamdywgqgtsvtvss
akttapsvyplapvcsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkiep

SCOPe Domain Coordinates for d4u1gb_:

Click to download the PDB-style file with coordinates for d4u1gb_.
(The format of our PDB-style files is described here.)

Timeline for d4u1gb_:

  • d4u1gb_ is new in SCOPe 2.08-stable