Lineage for d4rfea_ (4rfe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761543Domain d4rfea_: 4rfe A: [409541]
    Other proteins in same PDB: d4rfeb2, d4rfed2, d4rfef2, d4rfel2
    automated match to d6shgh_
    complexed with cl, gol, so4

Details for d4rfea_

PDB Entry: 4rfe (more details), 1.91 Å

PDB Description: crystal structure of adcc-potent anti-hiv-1 rhesus macaque antibody jr4 fab
PDB Compounds: (A:) Fab heavy chain of ADCC-potent anti-HIV-1 antibody JR4

SCOPe Domain Sequences for d4rfea_:

Sequence, based on SEQRES records: (download)

>d4rfea_ b.1.1.0 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qlvesgpglvkpletlsltcavpggsirrnywswirqppgkglewighsygsggstnynp
slesrvtlsvdtsknlfslkltsvtaadtavyycartvwyytsgthyfdhwgqgvlvtvs
sastkgpsvfplapssrstsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyvcnvnhkpsntkvdkrve

Sequence, based on observed residues (ATOM records): (download)

>d4rfea_ b.1.1.0 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qlvesgpglvkpletlsltcavpggsirrnywswirqppgkglewighsygsggstnynp
slesrvtlsvdtsknlfslkltsvtaadtavyycartvwyytsgthyfdhwgqgvlvtvs
sastkgpsvfplapsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqssglys
lssvvtvpssslgtqtyvcnvnhkpsntkvdkrve

SCOPe Domain Coordinates for d4rfea_:

Click to download the PDB-style file with coordinates for d4rfea_.
(The format of our PDB-style files is described here.)

Timeline for d4rfea_:

  • d4rfea_ is new in SCOPe 2.08-stable