Lineage for d4qthh1 (4qth H:9-224)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760253Domain d4qthh1: 4qth H:9-224 [409390]
    Other proteins in same PDB: d4qtha2, d4qthb2, d4qthh2, d4qthl2
    automated match to d6shgh_

Details for d4qthh1

PDB Entry: 4qth (more details), 2.17 Å

PDB Description: crystal structure of anti-upar fab 8b12
PDB Compounds: (H:) anti-uPAR antibody, heavy chain

SCOPe Domain Sequences for d4qthh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qthh1 b.1.1.0 (H:9-224) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelmkpgasvklsckaagytftaywiewirqrpghglewigeilpgssstncnemfkgka
tftadtssnsaymqlsslttedsaiyyctrdfsgdrsnlyfdvwgtgttvtvssakttpp
svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d4qthh1:

Click to download the PDB-style file with coordinates for d4qthh1.
(The format of our PDB-style files is described here.)

Timeline for d4qthh1:

  • d4qthh1 is new in SCOPe 2.08-stable