Lineage for d4pb0h_ (4pb0 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744989Domain d4pb0h_: 4pb0 H: [409339]
    Other proteins in same PDB: d4pb0l1, d4pb0l2
    automated match to d6shgh_
    complexed with cl, so4, trs

Details for d4pb0h_

PDB Entry: 4pb0 (more details), 2.5 Å

PDB Description: structure of the fab fragment of the anti-francisella tularensis groel antibody ab53
PDB Compounds: (H:) Ab53 heavy chain

SCOPe Domain Sequences for d4pb0h_:

Sequence, based on SEQRES records: (download)

>d4pb0h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkllesggglvqpggsmklscvasgftfsifwmnwvrqspekglewvaevrlksnnyat
hyaesvkgrftisrddsksgvylqmnnlraedtgiyyctrgyygsnygeywgqgttltvs
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Sequence, based on observed residues (ATOM records): (download)

>d4pb0h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkllesggglvqpggsmklscvasgftfsifwmnwvrqspekglewvaevrlksnnyat
hyaesvkgrftisrddsksgvylqmnnlraedtgiyyctrgyygsnygeywgqgttltvs
sakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOPe Domain Coordinates for d4pb0h_:

Click to download the PDB-style file with coordinates for d4pb0h_.
(The format of our PDB-style files is described here.)

Timeline for d4pb0h_:

  • d4pb0h_ is new in SCOPe 2.08-stable