Lineage for d4oz4h1 (4oz4 H:2-220)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) 
Domain d4oz4h1: 4oz4 H:2-220 [409333]
Other proteins in same PDB: d4oz4a2, d4oz4b1, d4oz4b2, d4oz4h2, d4oz4l1, d4oz4l2
automated match to d6shgh_
Details for d4oz4h1
PDB Entry: 4oz4 (more details), 3 Å
PDB Description: x-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.
PDB Compounds: (H:) Fab of monoclonal antibody, heavy chainSCOPe Domain Sequences for d4oz4h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oz4h1 b.1.1.1 (H:2-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgpelvkpgtsvkmpckasgyiftdyviswvkqrtgqglewigeifprsgstyyn
ekfkgkatltadkssntaymqlssvtsedsavyfcardyygtsfamdywgqgtsvtvssa
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
SCOPe Domain Coordinates for d4oz4h1:
Click to download the PDB-style file with coordinates for d4oz4h1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4oz4h1:
- d4oz4h1 is new in SCOPe 2.08-stable
View in 3D
