Lineage for d1muta_ (1mut A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871097Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 871199Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (1 species)
  7. 871200Species Escherichia coli [TaxId:562] [55814] (6 PDB entries)
  8. 871203Domain d1muta_: 1mut A: [40921]

Details for d1muta_

PDB Entry: 1mut (more details)

PDB Description: nmr study of mutt enzyme, a nucleoside triphosphate pyrophosphohydrolase
PDB Compounds: (A:) nucleoside triphosphate pyrophosphohydrolase

SCOP Domain Sequences for d1muta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muta_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]}
mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
pviaklkrl

SCOP Domain Coordinates for d1muta_:

Click to download the PDB-style file with coordinates for d1muta_.
(The format of our PDB-style files is described here.)

Timeline for d1muta_: