SCOPe 2.08: Domain d4ma8h1: 4ma8 H:9-218

Lineage for d4ma8h1 (4ma8 H:9-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d4ma8h1: 4ma8 H:9-218 [409193]
   Other proteins in same PDB: d4ma8h2, d4ma8l1, d4ma8l2
   automated match to d6shgh_
   complexed with z80

Details for d4ma8h1

PDB Entry: 4ma8, 2.2 Å

PDB Description: crystal structure of mouse prion protein complexed with chlorpromazine

PDB Compounds: (H:) POM1 heavy chain

SCOPe Domain Sequences for d4ma8h1:

Sequence; same for both SEQRES and ATOM records:

>d4ma8h1 b.1.1.1 (H:9-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
telvmpgasvkmsckasgytftdywmhwvkqrpgqglewigsidpsdsytshnekfkgka
tltvdessstaymqlssltsedsavyfcsrsgygyyameywgqgtsvtvssakttppsvy
plapgggatnsmvtlgclvkgyfpepvtvtwnsgslsggvhtfpavlqsdlytlsssvtv
psstwpsetvtcnvahpasstkvdkkivpr

Timeline for d4ma8h1:

• d4ma8h1 is new in SCOPe 2.08-stable