Lineage for d4liqh_ (4liq H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760461Domain d4liqh_: 4liq H: [409145]
    Other proteins in same PDB: d4liql2
    automated match to d6shgh_
    complexed with nag, so4

Details for d4liqh_

PDB Entry: 4liq (more details), 2.6 Å

PDB Description: structure of the extracellular domain of human csf-1 receptor in complex with the fab fragment of rg7155
PDB Compounds: (H:) Fab fragment RG7155 heavy chain

SCOPe Domain Sequences for d4liqh_:

Sequence, based on SEQRES records: (download)

>d4liqh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvqsgaevkkpgasvkvsckasgytftsydiswvrqapgqglewmgviwtdggtnya
qklqgrvtmttdtststaymelrslrsddtavyycardqrlyfdvwgqgttvtvssastk
gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d4liqh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvqsgaevkkpgasvkvsckasgytftsydiswvrqapgqglewmgviwtdggtnya
qklqgrvtmttdtststaymelrslrsddtavyycardqrlyfdvwgqgttvtvssastk
gpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d4liqh_:

Click to download the PDB-style file with coordinates for d4liqh_.
(The format of our PDB-style files is described here.)

Timeline for d4liqh_:

  • d4liqh_ is new in SCOPe 2.08-stable