Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4liqh_: 4liq H: [409145] Other proteins in same PDB: d4liql2 automated match to d6shgh_ complexed with nag, so4 |
PDB Entry: 4liq (more details), 2.6 Å
SCOPe Domain Sequences for d4liqh_:
Sequence, based on SEQRES records: (download)
>d4liqh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvqlvqsgaevkkpgasvkvsckasgytftsydiswvrqapgqglewmgviwtdggtnya qklqgrvtmttdtststaymelrslrsddtavyycardqrlyfdvwgqgttvtvssastk gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
>d4liqh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvqlvqsgaevkkpgasvkvsckasgytftsydiswvrqapgqglewmgviwtdggtnya qklqgrvtmttdtststaymelrslrsddtavyycardqrlyfdvwgqgttvtvssastk gpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv tvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d4liqh_: