Lineage for d4lf3b_ (4lf3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745030Domain d4lf3b_: 4lf3 B: [409143]
    Other proteins in same PDB: d4lf3a1, d4lf3a2, d4lf3d1, d4lf3d2
    automated match to d6shgh_

Details for d4lf3b_

PDB Entry: 4lf3 (more details), 2.73 Å

PDB Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor
PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d4lf3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf3b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvavmwydgsnkdy
vdsvkgrftisrdnskntlylqmnrlraedtavyycarekdhydiltgynyyygldvwgq
gttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht
fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d4lf3b_:

Click to download the PDB-style file with coordinates for d4lf3b_.
(The format of our PDB-style files is described here.)

Timeline for d4lf3b_:

  • d4lf3b_ is new in SCOPe 2.08-stable