Lineage for d4leoa_ (4leo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760611Domain d4leoa_: 4leo A: [409141]
    Other proteins in same PDB: d4leob2
    automated match to d6shgh_
    complexed with nag

Details for d4leoa_

PDB Entry: 4leo (more details), 2.64 Å

PDB Description: crystal structure of anti-her3 fab rg7116 in complex with the extracellular domains of human her3 (erbb3)
PDB Compounds: (A:) RG7116 Fab heavy chain

SCOPe Domain Sequences for d4leoa_:

Sequence, based on SEQRES records: (download)

>d4leoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvqsgaevkkpgasvkvsckasgytfrssyiswvrqapgqglewmgwiyagtgspsy
nqklqgrvtmttdtststaymelrslrsddtavyycarhrdyysnsltywgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d4leoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvqsgaevkkpgasvkvsckasgytfrssyiswvrqapgqglewmgwiyagtgspsy
nqklqgrvtmttdtststaymelrslrsddtavyycarhrdyysnsltywgqgtlvtvss
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d4leoa_:

Click to download the PDB-style file with coordinates for d4leoa_.
(The format of our PDB-style files is described here.)

Timeline for d4leoa_:

  • d4leoa_ is new in SCOPe 2.08-stable