Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4krod_: 4kro D: [409123] Other proteins in same PDB: d4krob2 automated match to d6shgh_ complexed with nag |
PDB Entry: 4kro (more details), 3.05 Å
SCOPe Domain Sequences for d4krod_:
Sequence, based on SEQRES records: (download)
>d4krod_ b.1.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvqlkqsgpglvqpsqslsitctvsgfsltnygvhwvrqspgkglewlgviwsggntdyn tpftsrlsinkdnsksqvffkmnslqsndtaiyycaraltyydyefaywgqgtlvtvsaa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrve
>d4krod_ b.1.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvqlkqsgpglvqpsqslsitctvsgfsltnygvhwvrqspgkglewlgviwsggntdyn tpftsrlsinkdnsksqvffkmnslqsndtaiyycaraltyydyefaywgqgtlvtvsaa stkgpsvfplapssktaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls svvtvpssslgtqtyicnvnhkpsntkvdkrve
Timeline for d4krod_:
View in 3D Domains from other chains: (mouse over for more information) d4krob1, d4krob2, d4kroc1, d4kroc2 |