Lineage for d4ki5e1 (4ki5 E:9-224)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) 
Domain d4ki5e1: 4ki5 E:9-224 [409100]
Other proteins in same PDB: d4ki5c_, d4ki5e2, d4ki5f2, d4ki5m_
automated match to d6shgh_
Details for d4ki5e1
PDB Entry: 4ki5 (more details), 2.47 Å
PDB Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99
PDB Compounds: (E:) murine monoclonal g99 fab heavy chainSCOPe Domain Sequences for d4ki5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ki5e1 b.1.1.0 (E:9-224) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstnynerfkgka
sftadsssntaymqlssltsedsavyyctrtsyyfgssydfdvwgagttvtvssakttap
svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkieprgp
SCOPe Domain Coordinates for d4ki5e1:
Click to download the PDB-style file with coordinates for d4ki5e1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ki5e1:
- d4ki5e1 is new in SCOPe 2.08-stable
View in 3D
