Lineage for d1drma_ (1drm A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261219Fold d.110: Profilin-like [55769] (5 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 261276Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (5 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 261297Family d.110.3.2: Histidine kinase FixL heme domain [55789] (1 protein)
  6. 261298Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 261299Species Bradyrhizobium japonicum [TaxId:375] [55792] (8 PDB entries)
  8. 261302Domain d1drma_: 1drm A: [40908]

Details for d1drma_

PDB Entry: 1drm (more details), 2.4 Å

PDB Description: crystal structure of the ligand free bjfixl heme domain

SCOP Domain Sequences for d1drma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drma_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum}
ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
dphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq

SCOP Domain Coordinates for d1drma_:

Click to download the PDB-style file with coordinates for d1drma_.
(The format of our PDB-style files is described here.)

Timeline for d1drma_: