Lineage for d1drma_ (1drm A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) Superfamily d.110.3: PYP-like sensor domain [55785] (3 families) 
Family d.110.3.2: Histidine kinase FixL heme domain [55789] (1 protein) Protein Histidine kinase FixL heme domain [55790] (2 species) 
Species Bradyrhizobium japonicum [TaxId:375] [55792] (5 PDB entries) 
Domain d1drma_: 1drm A: [40908]
Details for d1drma_
PDB Entry: 1drm (more details), 2.4 Å
PDB Description: crystal structure of the ligand free bjfixl heme domain
SCOP Domain Sequences for d1drma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1drma_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum}
ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
dphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq
SCOP Domain Coordinates for d1drma_:
Click to download the PDB-style file with coordinates for d1drma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1drma_:
- d1drma_ appears in SCOP 1.57
- d1drma_ appears in the current release, SCOPe 2.08
View in 3D