Lineage for d4jn2b1 (4jn2 B:7-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759752Domain d4jn2b1: 4jn2 B:7-226 [409062]
    Other proteins in same PDB: d4jn2a2, d4jn2b2, d4jn2h2, d4jn2l2
    automated match to d6shgh_
    complexed with 4cc, gol

Details for d4jn2b1

PDB Entry: 4jn2 (more details), 1.71 Å

PDB Description: an antidote for dabigatran
PDB Compounds: (B:) anti dabigatran Fab

SCOPe Domain Sequences for d4jn2b1:

Sequence, based on SEQRES records: (download)

>d4jn2b1 b.1.1.0 (B:7-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esgpglvkpsetlsltctvsgfsltsyivdwirqppgkglewigviwaggstgynsalrs
rvsitkdtsknqfslklssvtaadtavyycasaayysyynydgfaywgqgtlvtvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d4jn2b1 b.1.1.0 (B:7-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esgpglvkpsetlsltctvstsyivdwirqppgkglewigviwaggstgynsalrsrvsi
tkdtsknqfslklssvtaadtavyycasaayysyynydgfaywgqgtlvtvssastkgps
vfplapggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvps
sslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d4jn2b1:

Click to download the PDB-style file with coordinates for d4jn2b1.
(The format of our PDB-style files is described here.)

Timeline for d4jn2b1:

  • d4jn2b1 is new in SCOPe 2.08-stable