Lineage for d3phya_ (3phy A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2576906Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2576907Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 2576908Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (82 PDB entries)
    Uniprot P16113
  8. 2576991Domain d3phya_: 3phy A: [40904]
    dark state (unbleached)
    complexed with hc4

Details for d3phya_

PDB Entry: 3phy (more details)

PDB Description: photoactive yellow protein, dark state (unbleached), solution structure, nmr, 26 structures
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d3phya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phya_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d3phya_:

Click to download the PDB-style file with coordinates for d3phya_.
(The format of our PDB-style files is described here.)

Timeline for d3phya_: