Lineage for d3phy__ (3phy -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35199Fold d.110: Profilin-like [55769] (3 superfamilies)
  4. 35246Superfamily d.110.3: PYP-like sensor domain [55785] (3 families) (S)
  5. 35247Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein)
  6. 35248Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 35249Species Ectothiorhodospira halophila [TaxId:17] [55788] (8 PDB entries)
  8. 35257Domain d3phy__: 3phy - [40904]

Details for d3phy__

PDB Entry: 3phy (more details)

PDB Description: photoactive yellow protein, dark state (unbleached), solution structure, nmr, 26 structures

SCOP Domain Sequences for d3phy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phy__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d3phy__:

Click to download the PDB-style file with coordinates for d3phy__.
(The format of our PDB-style files is described here.)

Timeline for d3phy__: