SCOP 1.63: Domain d2phy__: 2phy -

Lineage for d2phy__ (2phy -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.110: Profilin-like [55769] (5 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (5 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (12 PDB entries)

8. Domain d2phy__: 2phy - [40901]
   complexed with hc4

Details for d2phy__

PDB Entry: 2phy, 1.4 Å

PDB Description: photoactive yellow protein, dark state (unbleached)

SCOP Domain Sequences for d2phy__:

Sequence; same for both SEQRES and ATOM records:

>d2phy__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d2phy__:

• d2phy__ first appeared (with stable ids) in SCOP 1.55
  
• d2phy__ appears in SCOP 1.61
  
• d2phy__ appears in SCOP 1.65
  
• d2phy__ appears in the current release, SCOPe 2.08, called d2phya_