Lineage for d2phy__ (2phy -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261219Fold d.110: Profilin-like [55769] (5 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 261276Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (5 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 261277Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 261278Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 261279Species Ectothiorhodospira halophila [TaxId:17] [55788] (12 PDB entries)
  8. 261285Domain d2phy__: 2phy - [40901]
    complexed with hc4

Details for d2phy__

PDB Entry: 2phy (more details), 1.4 Å

PDB Description: photoactive yellow protein, dark state (unbleached)

SCOP Domain Sequences for d2phy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phy__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d2phy__:

Click to download the PDB-style file with coordinates for d2phy__.
(The format of our PDB-style files is described here.)

Timeline for d2phy__: