Lineage for d2phy__ (2phy -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) Superfamily d.110.3: PYP-like sensor domain [55785] (3 families) 
Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein) Protein Photoactive yellow protein, PYP [55787] (1 species) Species Ectothiorhodospira halophila [TaxId:17] [55788] (8 PDB entries) 
Domain d2phy__: 2phy - [40901]
Details for d2phy__
PDB Entry: 2phy (more details), 1.4 Å
PDB Description: photoactive yellow protein, dark state (unbleached)
SCOP Domain Sequences for d2phy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2phy__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv
SCOP Domain Coordinates for d2phy__:
Click to download the PDB-style file with coordinates for d2phy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2phy__:
- d2phy__ appears in SCOP 1.57
- d2phy__ appears in the current release, SCOPe 2.08, called d2phya_
View in 3D