Lineage for d3pyp__ (3pyp -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195728Fold d.110: Profilin-like [55769] (6 superfamilies)
  4. 195781Superfamily d.110.3: PYP-like sensor domain [55785] (4 families) (S)
  5. 195782Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein)
  6. 195783Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 195784Species Ectothiorhodospira halophila [TaxId:17] [55788] (12 PDB entries)
  8. 195785Domain d3pyp__: 3pyp - [40897]

Details for d3pyp__

PDB Entry: 3pyp (more details), 0.85 Å

PDB Description: photoactive yellow protein, cryotrapped early light cycle intermediate

SCOP Domain Sequences for d3pyp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pyp__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d3pyp__:

Click to download the PDB-style file with coordinates for d3pyp__.
(The format of our PDB-style files is described here.)

Timeline for d3pyp__: