Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.110: Profilin-like [55769] (9 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Para rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry) |
Domain d1g5ub_: 1g5u B: [40894] complexed with na |
PDB Entry: 1g5u (more details), 3.1 Å
SCOP Domain Sequences for d1g5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ub_ d.110.1.1 (B:) Profilin (actin-binding protein) {Para rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]} swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver lgdylldqgl
Timeline for d1g5ub_: