Lineage for d1g5ua_ (1g5u A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) 
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) 
Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) Protein Profilin (actin-binding protein) [55772] (8 species) 
Species Para rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry) 
Domain d1g5ua_: 1g5u A: [40893]
Details for d1g5ua_
PDB Entry: 1g5u (more details), 3.1 Å
PDB Description: latex profilin hevb8
SCOP Domain Sequences for d1g5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ua_ d.110.1.1 (A:) Profilin (actin-binding protein) {Para rubber tree (Hevea brasiliensis), hevb8}
swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
lgdylldqgl
SCOP Domain Coordinates for d1g5ua_:
Click to download the PDB-style file with coordinates for d1g5ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g5ua_:
- d1g5ua_ appears in SCOP 1.57
- d1g5ua_ appears in the current release, SCOPe 2.08
View in 3D
