Lineage for d1g5ua_ (1g5u A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) 
alpha-beta(2)-alpha-beta(5)-alphaFamily d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
automatically mapped to Pfam PF00235
Protein Profilin (actin-binding protein) [55772] (8 species) 
Species Rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry) 
Domain d1g5ua_: 1g5u A: [40893]
complexed with na
Details for d1g5ua_
PDB Entry: 1g5u (more details), 3.1 Å
PDB Description: latex profilin hevb8
PDB Compounds: (A:) ProfilinSCOPe Domain Sequences for d1g5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ua_ d.110.1.1 (A:) Profilin (actin-binding protein) {Rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]}
swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
lgdylldqgl
SCOPe Domain Coordinates for d1g5ua_:
Click to download the PDB-style file with coordinates for d1g5ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g5ua_:
- d1g5ua_ first appeared (with stable ids) in SCOP 1.55
- d1g5ua_ appears in SCOPe 2.07
View in 3D
