| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
| Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) |
| Protein Profilin (actin-binding protein) [55772] (8 species) |
| Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [55779] (2 PDB entries) |
| Domain d1a0k__: 1a0k - [40892] |
PDB Entry: 1a0k (more details), 2.2 Å
SCOP Domain Sequences for d1a0k__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0k__ d.110.1.1 (-) Profilin (actin-binding protein) {Mouse-ear cress (Arabidopsis thaliana)}
swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
lgdyliesel
Timeline for d1a0k__: