Lineage for d3nul__ (3nul -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609437Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 609438Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 609439Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 609472Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [55779] (2 PDB entries)
  8. 609473Domain d3nul__: 3nul - [40891]
    complexed with gol, so4

Details for d3nul__

PDB Entry: 3nul (more details), 1.6 Å

PDB Description: Profilin I from Arabidopsis thaliana

SCOP Domain Sequences for d3nul__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nul__ d.110.1.1 (-) Profilin (actin-binding protein) {Mouse-ear cress (Arabidopsis thaliana)}
swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
lgdyliesel

SCOP Domain Coordinates for d3nul__:

Click to download the PDB-style file with coordinates for d3nul__.
(The format of our PDB-style files is described here.)

Timeline for d3nul__: