SCOP 1.69: Domain d3nul__: 3nul -

Lineage for d3nul__ (3nul -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [55779] (2 PDB entries)

8. Domain d3nul__: 3nul - [40891]

Details for d3nul__

PDB Entry: 3nul, 1.6 Å

PDB Description: Profilin I from Arabidopsis thaliana

SCOP Domain Sequences for d3nul__:

Sequence; same for both SEQRES and ATOM records:

>d3nul__ d.110.1.1 (-) Profilin (actin-binding protein) {Mouse-ear cress (Arabidopsis thaliana)}
swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
lgdyliesel

Timeline for d3nul__:

• d3nul__ first appeared (with stable ids) in SCOP 1.55
  
• d3nul__ appears in SCOP 1.67
  
• d3nul__ appears in SCOP 1.71
  
• d3nul__ appears in the current release, SCOPe 2.08, called d3nula_