Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [55779] (2 PDB entries) |
Domain d3nul__: 3nul - [40891] |
PDB Entry: 3nul (more details), 1.6 Å
SCOP Domain Sequences for d3nul__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nul__ d.110.1.1 (-) Profilin (actin-binding protein) {Mouse-ear cress (Arabidopsis thaliana)} swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver lgdyliesel
Timeline for d3nul__: