Lineage for d1yprb_ (1ypr B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417123Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 417124Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 417125Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 417126Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 417134Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries)
  8. 417136Domain d1yprb_: 1ypr B: [40889]

Details for d1yprb_

PDB Entry: 1ypr (more details), 2.3 Å

PDB Description: saccharomyces cerevisiae (yeast) profilin

SCOP Domain Sequences for d1yprb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yprb_ d.110.1.1 (B:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae)}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

SCOP Domain Coordinates for d1yprb_:

Click to download the PDB-style file with coordinates for d1yprb_.
(The format of our PDB-style files is described here.)

Timeline for d1yprb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ypra_