Lineage for d1ypra_ (1ypr A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609437Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 609438Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 609439Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 609447Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries)
  8. 609448Domain d1ypra_: 1ypr A: [40888]

Details for d1ypra_

PDB Entry: 1ypr (more details), 2.3 Å

PDB Description: saccharomyces cerevisiae (yeast) profilin

SCOP Domain Sequences for d1ypra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypra_ d.110.1.1 (A:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae)}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

SCOP Domain Coordinates for d1ypra_:

Click to download the PDB-style file with coordinates for d1ypra_.
(The format of our PDB-style files is described here.)

Timeline for d1ypra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yprb_