SCOP 1.69: Domain d1ypra_: 1ypr A:

Lineage for d1ypra_ (1ypr A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries)

8. Domain d1ypra_: 1ypr A: [40888]

Details for d1ypra_

PDB Entry: 1ypr, 2.3 Å

PDB Description: saccharomyces cerevisiae (yeast) profilin

SCOP Domain Sequences for d1ypra_:

Sequence; same for both SEQRES and ATOM records:

>d1ypra_ d.110.1.1 (A:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae)}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

Timeline for d1ypra_:

• d1ypra_ first appeared (with stable ids) in SCOP 1.55
  
• d1ypra_ appears in SCOP 1.67
  
• d1ypra_ appears in SCOP 1.71
  
• d1ypra_ appears in the current release, SCOPe 2.08