Lineage for d2prf__ (2prf -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609437Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 609438Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 609439Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 609440Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries)
  8. 609446Domain d2prf__: 2prf - [40887]

Details for d2prf__

PDB Entry: 2prf (more details)

PDB Description: three dimensional solution structure of acanthamoeba profilin i

SCOP Domain Sequences for d2prf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prf__ d.110.1.1 (-) Profilin (actin-binding protein) {Acanthamoeba castellanii}
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgqtlasafnnadpirasgf
dlagvhyvtlraddrsiygkkgsagvitvktsksilvgvynekiqpgtaanvvekladyl
igqgf

SCOP Domain Coordinates for d2prf__:

Click to download the PDB-style file with coordinates for d2prf__.
(The format of our PDB-style files is described here.)

Timeline for d2prf__: