Lineage for d2prf__ (2prf -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) 
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) 
Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) Protein Profilin (actin-binding protein) [55772] (8 species) 
Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries) 
Domain d2prf__: 2prf - [40887]
Details for d2prf__
PDB Entry: 2prf (more details)
PDB Description: three dimensional solution structure of acanthamoeba profilin i
SCOP Domain Sequences for d2prf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prf__ d.110.1.1 (-) Profilin (actin-binding protein) {Acanthamoeba castellanii}
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgqtlasafnnadpirasgf
dlagvhyvtlraddrsiygkkgsagvitvktsksilvgvynekiqpgtaanvvekladyl
igqgf
SCOP Domain Coordinates for d2prf__:
Click to download the PDB-style file with coordinates for d2prf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2prf__:
- d2prf__ appears in SCOP 1.57
- d2prf__ appears in the current release, SCOPe 2.08, called d2prfa_
View in 3D