SCOP 1.69: Domain d2acg__: 2acg -

Lineage for d2acg__ (2acg -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries)

8. Domain d2acg__: 2acg - [40886]

Details for d2acg__

PDB Entry: 2acg, 2.5 Å

PDB Description: acanthamoeba castellanii profilin ii

SCOP Domain Sequences for d2acg__:

Sequence; same for both SEQRES and ATOM records:

>d2acg__ d.110.1.1 (-) Profilin (actin-binding protein) {Acanthamoeba castellanii}
swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
igqgf

Timeline for d2acg__:

• d2acg__ first appeared (with stable ids) in SCOP 1.55
  
• d2acg__ appears in SCOP 1.67
  
• d2acg__ appears in SCOP 1.71
  
• d2acg__ appears in the current release, SCOPe 2.08, called d2acga_