Lineage for d4cnia_ (4cni A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742904Domain d4cnia_: 4cni A: [408850]
    Other proteins in same PDB: d4cnib1, d4cnib2, d4cnic_, d4cnid_, d4cnil1, d4cnil2
    automated match to d6shgh_
    complexed with so4, tam

Details for d4cnia_

PDB Entry: 4cni (more details), 2.2 Å

PDB Description: crystal structure of the fab portion of olokizumab in complex with il- 6
PDB Compounds: (A:) olokizumab heavy chain, fab portion

SCOPe Domain Sequences for d4cnia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cnia_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnfndyfmnwvrqapgkglewvaqmrnknyqygt
yyaeslegrftisrddsknslylqmnslktedtavyycaresyygftsywgqgtlvtvss
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrves

SCOPe Domain Coordinates for d4cnia_:

Click to download the PDB-style file with coordinates for d4cnia_.
(The format of our PDB-style files is described here.)

Timeline for d4cnia_:

  • d4cnia_ is new in SCOPe 2.08-stable