SCOP 1.69: Domain d1f2kb_: 1f2k B:

Lineage for d1f2kb_ (1f2k B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries)

8. Domain d1f2kb_: 1f2k B: [40885]

Details for d1f2kb_

PDB Entry: 1f2k, 2.3 Å

PDB Description: crystal structure of acanthamoeba castellanii profilin ii, cubic crystal form

SCOP Domain Sequences for d1f2kb_:

Sequence; same for both SEQRES and ATOM records:

>d1f2kb_ d.110.1.1 (B:) Profilin (actin-binding protein) {Acanthamoeba castellanii}
swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
igqgf

Timeline for d1f2kb_:

• d1f2kb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2kb_ appears in SCOP 1.67
  
• d1f2kb_ appears in SCOP 1.71
  
• d1f2kb_ appears in the current release, SCOPe 2.08