Lineage for d1acf__ (1acf -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609437Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 609438Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 609439Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 609440Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries)
  8. 609441Domain d1acf__: 1acf - [40882]

Details for d1acf__

PDB Entry: 1acf (more details), 2 Å

PDB Description: acanthamoeba castellanii profilin ib

SCOP Domain Sequences for d1acf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acf__ d.110.1.1 (-) Profilin (actin-binding protein) {Acanthamoeba castellanii}
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgttlagafnnadairaggf
dlagvhyvtlraddrsiygkkgssgvitvktskailvgvynekiqpgtaanvvekladyl
igqgf

SCOP Domain Coordinates for d1acf__:

Click to download the PDB-style file with coordinates for d1acf__.
(The format of our PDB-style files is described here.)

Timeline for d1acf__: