SCOP 1.73: Domain d1d1jd_: 1d1j D:

Lineage for d1d1jd_ (1d1j D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Human (Homo sapiens), isoform II [TaxId:9606] [55775] (1 PDB entry)

8. Domain d1d1jd_: 1d1j D: [40881]

Details for d1d1jd_

PDB Entry: 1d1j, 2.2 Å

PDB Description: crystal structure of human profilin ii

PDB Compounds: (D:) profilin II

SCOP Domain Sequences for d1d1jd_:

Sequence; same for both SEQRES and ATOM records:

>d1d1jd_ d.110.1.1 (D:) Profilin (actin-binding protein) {Human (Homo sapiens), isoform II [TaxId: 9606]}
agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
gtlnkkayelalylrrsd

Timeline for d1d1jd_:

• d1d1jd_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1jd_ appears in SCOP 1.71
  
• d1d1jd_ appears in SCOP 1.75
  
• d1d1jd_ appears in the current release, SCOPe 2.08