Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Human (Homo sapiens), isoform II [TaxId:9606] [55775] (1 PDB entry) |
Domain d1d1ja_: 1d1j A: [40878] complexed with pg5, pg6, so4 |
PDB Entry: 1d1j (more details), 2.2 Å
SCOPe Domain Sequences for d1d1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1ja_ d.110.1.1 (A:) Profilin (actin-binding protein) {Human (Homo sapiens), isoform II [TaxId: 9606]} agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg gtlnkkayelalylrrsd
Timeline for d1d1ja_: