Lineage for d3wkmi_ (3wkm I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744650Domain d3wkmi_: 3wkm I: [408774]
    Other proteins in same PDB: d3wkml1, d3wkml2, d3wkmm1, d3wkmm2
    automated match to d6shgh_

Details for d3wkmi_

PDB Entry: 3wkm (more details), 2.2 Å

PDB Description: The periplasmic PDZ tandem fragment of the RseP homologue from Aquifex aeolicus in complex with the Fab fragment
PDB Compounds: (I:) mouse igg1-kappa fab (heavy chain)

SCOPe Domain Sequences for d3wkmi_:

Sequence, based on SEQRES records: (download)

>d3wkmi_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtylhwvkqrpehglewigridpangnaky
dpkfqdkatitadtssntaylqlnsltsedtavyycsnrqlglrgyyyamdywgqgtsvs
vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdk

Sequence, based on observed residues (ATOM records): (download)

>d3wkmi_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtylhwvkqrpehglewigridpangnaky
dpkfqdkatitadtssntaylqlnsltsedtavyycsnrqlglrgyyyamdywgqgtsvs
vssakttppsvyplalgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
cnvahpasstkvdk

SCOPe Domain Coordinates for d3wkmi_:

Click to download the PDB-style file with coordinates for d3wkmi_.
(The format of our PDB-style files is described here.)

Timeline for d3wkmi_:

  • d3wkmi_ is new in SCOPe 2.08-stable