Lineage for d3vi3f_ (3vi3 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745012Domain d3vi3f_: 3vi3 F: [408753]
    Other proteins in same PDB: d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e1, d3vi3e2, d3vi3l1, d3vi3l2
    automated match to d6shgh_
    complexed with ca, mg, nag

Details for d3vi3f_

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
PDB Compounds: (F:) SG/19 Fab fragment (Heavy chain)

SCOPe Domain Sequences for d3vi3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi3f_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvhlqqsgaelmkpgasvkisckatgytftsywiewvkqrpghglewlgeilpgsgyihy
nekfkgkatfttdtssntaymqlssltsedsavyycsralalyamdywgqgtsvtvssak
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d3vi3f_:

Click to download the PDB-style file with coordinates for d3vi3f_.
(The format of our PDB-style files is described here.)

Timeline for d3vi3f_:

  • d3vi3f_ is new in SCOPe 2.08-stable