Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Human (Homo sapiens), isoform I [TaxId:9606] [55774] (6 PDB entries) |
Domain d1cf0b_: 1cf0 B: [40874] |
PDB Entry: 1cf0 (more details), 2.2 Å
SCOP Domain Sequences for d1cf0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf0b_ d.110.1.1 (B:) Profilin (actin-binding protein) {Human (Homo sapiens), isoform I} gwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyvn gltlggqkcsvirdsllqdgefsmdlrtkstggaptfnvtvtktdktlvllmgkegvhgg linkkcyemashlrrsqy
Timeline for d1cf0b_: