Lineage for d3u9pk_ (3u9p K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761388Domain d3u9pk_: 3u9p K: [408713]
    Other proteins in same PDB: d3u9pc_, d3u9pd_
    automated match to d6shgh_

Details for d3u9pk_

PDB Entry: 3u9p (more details), 2.8 Å

PDB Description: crystal structure of murine siderocalin in complex with an fab fragment
PDB Compounds: (K:) Monoclonal Fab Fragment Heavy Chain

SCOPe Domain Sequences for d3u9pk_:

Sequence, based on SEQRES records: (download)

>d3u9pk_ b.1.1.0 (K:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evklqesgpslvqpsqtlsltctvsgfsltsnsvhwvrqppgqglewmggiwgdgrtdyn
salksrlsisrdtsksqvflkmnslqtddtaiyfctrcrrdssyvvdawgqgasvtvssa
kttpklvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsgl
ytltssvtsstwpsqtvtcnvahpasstkvdkkler

Sequence, based on observed residues (ATOM records): (download)

>d3u9pk_ b.1.1.0 (K:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evklqesgpslvqpsqtlsltctvsgfsltsnsvhwvrqppgqglewmggiwgdgrtdyn
salksrlsisrdtsksqvflkmnslqtddtaiyfctrcrrdssyvvdawgqgasvtvssa
kttpklvyplapvtlgclvkgyfpepvtvtwnsgalvhtfpavlqsglytltssvtsstw
vtcnvahpasstkvdkkler

SCOPe Domain Coordinates for d3u9pk_:

Click to download the PDB-style file with coordinates for d3u9pk_.
(The format of our PDB-style files is described here.)

Timeline for d3u9pk_:

  • d3u9pk_ is new in SCOPe 2.08-stable