SCOPe 2.08: Domain d3tnnh_: 3tnn H:

Lineage for d3tnnh_ (3tnn H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d3tnnh_: 3tnn H: [408694]
   Other proteins in same PDB: d3tnnb1, d3tnnb2, d3tnnd1, d3tnnd2, d3tnnf1, d3tnnf2, d3tnnl1, d3tnnl2
   automated match to d6shgh_
   complexed with cl, gol, so4

Details for d3tnnh_

PDB Entry: 3tnn, 1.95 Å

PDB Description: crystal structure of n5-i5 fab, an adcc mediating and non-neutralizing cd4i anti-hiv- 1 antibody.

PDB Compounds: (H:) Fab heavy chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5

SCOPe Domain Sequences for d3tnnh_:

Sequence, based on SEQRES records:

>d3tnnh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfstyamswvrqapgkglewvssinnsgrntfs
adsvkgrftisrdnskntlflvmnslraedtavyycakdlrlgggsdywgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrve

Sequence, based on observed residues (ATOM records):

>d3tnnh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfstyamswvrqapgkglewvssinnsgrntfs
adsvkgrftisrdnskntlflvmnslraedtavyycakdlrlgggsdywgqgtlvtvssa
stkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkrve

Timeline for d3tnnh_:

• d3tnnh_ is new in SCOPe 2.08-stable