SCOPe 2.08: Domain d3t3ph_: 3t3p H:

Lineage for d3t3ph_ (3t3p H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3t3ph_: 3t3p H: [408682]
   Other proteins in same PDB: d3t3pa_, d3t3pc_, d3t3pf1, d3t3pf2, d3t3pl1, d3t3pl2
   automated match to d6shgh_
   complexed with ca, cl, gol, mg, nag, so4

Details for d3t3ph_

PDB Entry: 3t3p, 2.2 Å

PDB Description: a novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas

PDB Compounds: (H:) monoclonal antibody 10e5 heavy chain

SCOPe Domain Sequences for d3t3ph_:

Sequence, based on SEQRES records:

>d3t3ph_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records):

>d3t3ph_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvctgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d3t3ph_:

• d3t3ph_ is new in SCOPe 2.08-stable