Lineage for d1hlup_ (1hlu P:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609437Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 609438Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 609439Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 609453Species Cow (Bos taurus) [TaxId:9913] [55773] (3 PDB entries)
  8. 609456Domain d1hlup_: 1hlu P: [40868]
    Other proteins in same PDB: d1hlua1, d1hlua2
    complexed with ace, atp, ca

Details for d1hlup_

PDB Entry: 1hlu (more details), 2.65 Å

PDB Description: structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible

SCOP Domain Sequences for d1hlup_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlup_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus)}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

SCOP Domain Coordinates for d1hlup_:

Click to download the PDB-style file with coordinates for d1hlup_.
(The format of our PDB-style files is described here.)

Timeline for d1hlup_: