SCOP 1.67: Domain d1hlup_: 1hlu P:

Lineage for d1hlup_ (1hlu P:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55773] (3 PDB entries)

8. Domain d1hlup_: 1hlu P: [40868]
   Other proteins in same PDB: d1hlua1, d1hlua2
   complexed with ace, atp, ca

Details for d1hlup_

PDB Entry: 1hlu, 2.65 Å

PDB Description: structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible

SCOP Domain Sequences for d1hlup_:

Sequence; same for both SEQRES and ATOM records:

>d1hlup_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus)}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

Timeline for d1hlup_:

• d1hlup_ first appeared (with stable ids) in SCOP 1.55
  
• d1hlup_ appears in SCOP 1.65
  
• d1hlup_ appears in SCOP 1.69
  
• d1hlup_ appears in the current release, SCOPe 2.08