![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) |
![]() | Protein Profilin (actin-binding protein) [55772] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [55773] (3 PDB entries) |
![]() | Domain d1hlup_: 1hlu P: [40868] Other proteins in same PDB: d1hlua1, d1hlua2 complexed with ace, atp, ca |
PDB Entry: 1hlu (more details), 2.65 Å
SCOP Domain Sequences for d1hlup_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlup_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus)} agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg gminkkcyemashlrrsqy
Timeline for d1hlup_: