Lineage for d2btfp_ (2btf P:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731579Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 731580Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 731581Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 731595Species Cow (Bos taurus) [TaxId:9913] [55773] (3 PDB entries)
  8. 731597Domain d2btfp_: 2btf P: [40867]
    Other proteins in same PDB: d2btfa1, d2btfa2
    complexed with atp, ch3, sr

Details for d2btfp_

PDB Entry: 2btf (more details), 2.55 Å

PDB Description: the structure of crystalline profilin-beta-actin
PDB Compounds: (P:) Profilin

SCOP Domain Sequences for d2btfp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btfp_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

SCOP Domain Coordinates for d2btfp_:

Click to download the PDB-style file with coordinates for d2btfp_.
(The format of our PDB-style files is described here.)

Timeline for d2btfp_: