SCOP 1.67: Domain d2btfp_: 2btf P:

Lineage for d2btfp_ (2btf P:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55773] (3 PDB entries)

8. Domain d2btfp_: 2btf P: [40867]
   Other proteins in same PDB: d2btfa1, d2btfa2
   complexed with atp, ch3, sr

Details for d2btfp_

PDB Entry: 2btf, 2.55 Å

PDB Description: the structure of crystalline profilin-beta-actin

SCOP Domain Sequences for d2btfp_:

Sequence; same for both SEQRES and ATOM records:

>d2btfp_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus)}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

Timeline for d2btfp_:

• d2btfp_ first appeared (with stable ids) in SCOP 1.55
  
• d2btfp_ appears in SCOP 1.65
  
• d2btfp_ appears in SCOP 1.69
  
• d2btfp_ appears in the current release, SCOPe 2.08