SCOP 1.71: Domain d1pne__: 1pne -

Lineage for d1pne__ (1pne -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55773] (3 PDB entries)

8. Domain d1pne__: 1pne - [40866]

Details for d1pne__

PDB Entry: 1pne, 2 Å

PDB Description: crystallization and structure determination of bovine profilin at 2.0 angstroms resolution

SCOP Domain Sequences for d1pne__:

Sequence; same for both SEQRES and ATOM records:

>d1pne__ d.110.1.1 (-) Profilin (actin-binding protein) {Cow (Bos taurus)}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

Timeline for d1pne__:

• d1pne__ first appeared (with stable ids) in SCOP 1.55
  
• d1pne__ appears in SCOP 1.69
  
• d1pne__ is called d1pnea_ in SCOP 1.73
  
• d1pne__ appears in the current release, SCOPe 2.08, called d1pnea_