Lineage for d3r4dd_ (3r4d D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.26: Coronavirus spike glycoprotein S1, N-terminal domain [418798] (2 proteins)
    Pfam PF16451
  6. Protein Coronavirus spike glycoprotein S1 [419101] (4 species)
  7. Species Murine coronavirus [TaxId:694005] [419611] (1 PDB entry)
  8. Domain d3r4dd_: 3r4d D: [408644]
    Other proteins in same PDB: d3r4da1, d3r4da2, d3r4dc1, d3r4dc2
    automated match to d3r4db_
    complexed with nag

Details for d3r4dd_

PDB Entry: 3r4d (more details), 3.1 Å

PDB Description: crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor
PDB Compounds: (D:) Spike glycoprotein

SCOPe Domain Sequences for d3r4dd_:

Sequence, based on SEQRES records: (download)

>d3r4dd_ b.29.1.26 (D:) Coronavirus spike glycoprotein S1 {Murine coronavirus [TaxId: 694005]}
yigdfrciqlvnsnganvsapsistetvevsqglgtyyvldrvylnatllltgyypvdgs
kfrnlaltgtnsvslswfqppylsqfndgifakvqnlktstpsgatayfptivigslfgy
tsytvviepyngvimasvcqyticqlpytdckpntngnkligfwhtdvkppicvlkrnft
lnvnadafyfhfyqhggtfyayyadkpsattflfsvyigdiltqyyvlpficnptagstf
aprywvtplvkrqy

Sequence, based on observed residues (ATOM records): (download)

>d3r4dd_ b.29.1.26 (D:) Coronavirus spike glycoprotein S1 {Murine coronavirus [TaxId: 694005]}
yigdfrciqlvnsnganvsapsistltgyypvdgskfrnlaltgtnsvslswfqppylsq
fndgifakvqnlktstpsgatayfptivigslfgytsytvviepyngvimasvcqyticq
lpytdckpntngnkligfwhtdvkppicvlkrnftlnvnadafyfhfyqhggtfyayyad
kpsattflfsvyigdiltqyyvlpficnptagstfaprywvtplvkrqy

SCOPe Domain Coordinates for d3r4dd_ are not available.

Timeline for d3r4dd_:

  • d3r4dd_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3r4da1, d3r4da2, d3r4db_, d3r4dc1, d3r4dc2