Lineage for d3r06b_ (3r06 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742202Species Cricetulus migratorius [TaxId:10032] [419867] (1 PDB entry)
  8. 2742203Domain d3r06b_: 3r06 B: [408637]
    Other proteins in same PDB: d3r06a1, d3r06a2, d3r06c1, d3r06c2, d3r06e1, d3r06e2, d3r06l1, d3r06l2
    automated match to d6shgh_

Details for d3r06b_

PDB Entry: 3r06 (more details), 2.5 Å

PDB Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment
PDB Compounds: (B:) anti-mouse CD3epsilon antibody 2C11 Fab heavy chain

SCOPe Domain Sequences for d3r06b_:

Sequence, based on SEQRES records: (download)

>d3r06b_ b.1.1.1 (B:) automated matches {Cricetulus migratorius [TaxId: 10032]}
evqlvesggglvqpgkslklsceasgftfsgygmhwvrqapgrglesvayitsssiniky
adavkgrftvsrdnaknllflqmnilksedtamyycarfdwdknywgqgtmvtvssaktt
apsvyplapacdsttsttntvtlgclvkgyfpepvtviwnsgaltsgvhtfpsvlhsgly
slsssvtvpsstwpsqtvtcnvahpassttvdlkie

Sequence, based on observed residues (ATOM records): (download)

>d3r06b_ b.1.1.1 (B:) automated matches {Cricetulus migratorius [TaxId: 10032]}
evqlvesggglvqpgkslklsceasgftfsgygmhwvrqapgrglesvayitsssiniky
adavkgrftvsrdnaknllflqmnilksedtamyycarfdwdknywgqgtmvtvssaktt
apsvyplapattntvtlgclvkgyfpepvtviwnsgaltsgvhtfpsvlhsglyslsssv
tvpsstwpsqtvtcnvahpassttvdlkie

SCOPe Domain Coordinates for d3r06b_:

Click to download the PDB-style file with coordinates for d3r06b_.
(The format of our PDB-style files is described here.)

Timeline for d3r06b_:

  • d3r06b_ is new in SCOPe 2.08-stable